Basic Information | |
---|---|
Taxon OID | 3300006561 Open in IMG/M |
Scaffold ID | Ga0101389_1000200 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Black Sea in Odessa region - Od_1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1642 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Vapnyarka, Odessa Oblast, Ukraine | |||||||
Coordinates | Lat. (o) | 46.35116 | Long. (o) | 30.5519 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070145 | Metagenome / Metatranscriptome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101389_10002001 | F070145 | N/A | KQSRKANEETRGDLKKPKHKGNFWCHERKDFFKWEEFRNYNYKT* |
⦗Top⦘ |