NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075506_1487483

Scaffold Ga0075506_1487483


Overview

Basic Information
Taxon OID3300006401 Open in IMG/M
Scaffold IDGa0075506_1487483 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)901
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F015402Metagenome / Metatranscriptome255Y
F016004Metagenome / Metatranscriptome250Y
F070147Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0075506_14874831F015402N/AMGKTKELLDELESRDDYDYQYQQWLESKEFVEYVNGELDSTRPRYSEYDIMSATRYASEYITLEPSEVGKKVYDMLFSEKVEEYLTCKTLG*
Ga0075506_14874832F006200N/AMSEKKMSDWMERLVKKYSVPTNDKKEKRGILNETQLNNLKNGKN*
Ga0075506_14874833F016004GGTGGMNEELLKILETLKEDFEMLQDGRWDLNYSDGSEIEASLENVEKAINIIKNNE*
Ga0075506_14874834F070147N/AMKDVLLLILEAASVDMKRRCEQNTCEESRDTYGKWHGQIITMINTIKNGGVK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.