NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068481_1381312

Scaffold Ga0068481_1381312


Overview

Basic Information
Taxon OID3300006339 Open in IMG/M
Scaffold IDGa0068481_1381312 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1786
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (36.36%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008561Metagenome / Metatranscriptome331Y
F024883Metagenome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0068481_138131210F024883GAGMKLKKRKTSKVWKEVLETVEAFKDNPEYAPDPDHVQIYITTKDGGIVELHIGHDDEGEILKTFDSFDSEDDLEEQRIMERMEDPEGGILLN*
Ga0068481_13813129F008561AGGMKFEKLIEHYERAIGFESTVKGVPMSEENLELCRKFVTDIHDCPRQDVRVMYRGPRTSTGNGTLRKDALSFDVYHTPR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.