NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068481_1192695

Scaffold Ga0068481_1192695


Overview

Basic Information
Taxon OID3300006339 Open in IMG/M
Scaffold IDGa0068481_1192695 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2369
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020384Metagenome / Metatranscriptome224N
F021552Metagenome / Metatranscriptome218Y
F037762Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0068481_11926951F037762N/AMSNWKNFERRVAAKVGGKRIPITGRKCLDIDHPFLDIECKYRKSLPAWLFKDAWGQANTGSGIPVIAVSEYNSNNIFTITSIDTLVMLLDESIIDRNE*
Ga0068481_11926952F021552GGAGMIRHLIGKSLSTCTKDILDGTIDEGEVLLICTSTRHPFNDPNHFYDMRWFDSTKEAELLQRLYKQGRIHQPRMLSDSYNHGQEEFLFPYDNYRHKVWYSIKDQALTDLEDEQLEEL*
Ga0068481_11926955F020384N/AMHNKKIHSYQRSLQKLRNIVSETLRSSGQGRQIEFDNQMRRAIRHIQIIKRNVPSGDKGDSAMVEAYRLYDRLQRLSQYPTYFVDNTRKNPGRVASDRGRDYTNARPASVRWDVASMMAVPMTGEDRNWWRPPPRPAPVKHYTREELELEYPAFTVSKKRKDDA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.