| Basic Information | |
|---|---|
| Taxon OID | 3300006336 Open in IMG/M |
| Scaffold ID | Ga0068502_1021748 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 518 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Hawaiian Drosophila → picture wing clade → grimshawi clade → grimshawi group → grimshawi subgroup → Drosophila grimshawi | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059336 | Metagenome | 134 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068502_10217481 | F059336 | N/A | VVEQTVKEPEPVVEQTVKEPEPVVEQTVKEPEPKIQHLIFDSSIISYIMLDNNQVIKGIQNFSAEETKFLTIDAVINEFIEKEQLTYNRILTFDQIVNKLKQIGNFQYYGFDSNSDIAKRASTLFEAEKYVDNSDILEEKKLSMSDCILIELLIEKSVVLVTNDSLLKQAVE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |