Basic Information | |
---|---|
Taxon OID | 3300006237 Open in IMG/M |
Scaffold ID | Ga0097621_100776032 Open in IMG/M |
Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 887 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: South Gull Lake, Michigan | |||||||
Coordinates | Lat. (o) | 42.405765 | Long. (o) | -85.399014 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016440 | Metagenome / Metatranscriptome | 247 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0097621_1007760322 | F016440 | GGAG | MQRVSAAEEEAFLHAEACELAVLSTEHVRCAAAGRKPKSILHTLSVELSVLIGLDDKERLDRLVAEATRLLAREGRHDAITVLQATSSRLQEVALSQASH* |
⦗Top⦘ |