NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082206_134447

Scaffold Ga0082206_134447


Overview

Basic Information
Taxon OID3300006225 Open in IMG/M
Scaffold IDGa0082206_134447 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)852
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location
Location NameAlnarp, Sweden
CoordinatesLat. (o)59.8152338Long. (o)17.6620518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009968Metagenome / Metatranscriptome310Y
F053364Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0082206_1344471F053364AGGGGGVSDPLNDILVECCKLRGCYPLMHRTLHEFNWFCSCAISGAGPFIDIEIATAEADGDEALAGVLKDRRNEENGIRDRFGEWYSHGSDELIRLAEAFRIYCR
Ga0082206_1344472F009968AGGGGGVNTCIGCRSHYRERHWWLFEIDFCGLTGDVVGFECPIGCIDTRGCSAYERAFSWPRGAIA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.