


| Basic Information | |
|---|---|
| Taxon OID | 3300006201 Open in IMG/M |
| Scaffold ID | Ga0081180_1025915 Open in IMG/M |
| Source Dataset Name | Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t30_691P_inflammed - viral_metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas Southwestern Medical Center |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 734 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UTSWMC, Dallas, Texas, USA | |||||||
| Coordinates | Lat. (o) | 32.73 | Long. (o) | -96.97 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047755 | Metagenome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081180_10259151 | F047755 | N/A | VKNVINIIKDMNIKDKLRLAICMNDSQWLTLNYNRKEMYNKFDTHLRKIDEEYRTTLINFGQSKYFIINFTMAKLMEMEQTDRNKIALYLFNSMSMLC* |
| ⦗Top⦘ |