Basic Information | |
---|---|
Taxon OID | 3300006080 Open in IMG/M |
Scaffold ID | Ga0081602_1179170 Open in IMG/M |
Source Dataset Name | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid E |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Plant Breeding Research |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 942 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Manus Basin, Bismarck Sea | |||||||
Coordinates | Lat. (o) | -3.720639 | Long. (o) | 151.675313 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078841 | Metagenome / Metatranscriptome | 116 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0081602_11791701 | F078841 | AGAAG | MFDDSDVVHSESRSDKAKRAISEYLDEYGQVRATELKKEVCDELGICSEKIFYRCLFELVKSKRIIKNEQNRGNVSYYKPDWGVYENMINIDVIKQGTSTVRILAEVGRHENEVMQLTLLKMAFDNIMGMYASMTLITQQPGKAKTSAIITSTLKNTIPELLEMFSIALEKCGKNRSRIL |
⦗Top⦘ |