NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081592_1223890

Scaffold Ga0081592_1223890


Overview

Basic Information
Taxon OID3300006076 Open in IMG/M
Scaffold IDGa0081592_1223890 Open in IMG/M
Source Dataset NameMicrobial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Plant Breeding Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)578
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea

Source Dataset Sampling Location
Location NameManus Basin, Bismarck Sea
CoordinatesLat. (o)-3.7999163Long. (o)152.1008595Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007608Metagenome / Metatranscriptome348Y

Sequences

Protein IDFamilyRBSSequence
Ga0081592_12238903F007608AGGAGMQQENKYEKLPNSMYPKVRQQVVDRIATFEKVIEEHAAAQKEALKMVYEQLEEAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.