| Basic Information | |
|---|---|
| Taxon OID | 3300006076 Open in IMG/M |
| Scaffold ID | Ga0081592_1103911 Open in IMG/M |
| Source Dataset Name | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1117 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids → Microbial Communities In Diffuse Hydrothermal Fluids Of Manus Basin, Bismarck Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Manus Basin, Bismarck Sea | |||||||
| Coordinates | Lat. (o) | -3.7999163 | Long. (o) | 152.1008595 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017222 | Metagenome | 242 | Y |
| F045361 | Metagenome | 153 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0081592_11039111 | F045361 | GAGG | MVRMLMMMGLVVGAYVAGYNGVTHVEVMEFVESSMSYVEGMMEYAEGFRDEANSVIESVSERVESVL* |
| Ga0081592_11039113 | F017222 | N/A | MKIKLHARNIDNKLRTALYAMTSFAMAELIPSERLRNNVSINVHLKHHEEDGEAMLEEYANRYRPRDFKVIIDHHRAEIDDYGRTRSETEWGHTILRTLAHELVHVKQYLVGDLSWRDKGMLWGGEVFAPEYLTEQLKTPY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |