Basic Information | |
---|---|
Taxon OID | 3300005994 Open in IMG/M |
Scaffold ID | Ga0066789_10178444 Open in IMG/M |
Source Dataset Name | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 898 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alaska, USA | |||||||
Coordinates | Lat. (o) | 68.6135 | Long. (o) | -149.3144 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010718 | Metagenome / Metatranscriptome | 300 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066789_101784441 | F010718 | N/A | MRGLIVLAAMVVSTSVFGQECIRPEWGKCVSFPNGGSHTGMSIQKEKIQAEVTPGPDICVINEEEIGGYTFARFARNGTPWPTADWAANVDDFCFYTK* |
⦗Top⦘ |