NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070742_10004998

Scaffold Ga0070742_10004998


Overview

Basic Information
Taxon OID3300005942 Open in IMG/M
Scaffold IDGa0070742_10004998 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary, USA - metaG S.757
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3467
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000980Metagenome / Metatranscriptome814Y
F002387Metagenome / Metatranscriptome565Y

Sequences

Protein IDFamilyRBSSequence
Ga0070742_1000499810F002387AGGCGGMASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIQDEFNKFYDIKEGDE
Ga0070742_100049983F000980N/AMTKYQKYTWVCTGDCDALIEYTCKDGYGWPNGVIDLTCPCNSKCTLLSVEDATIPYTDTPLTKEETMETETPAVTIPDTYNANLLVTYKVIRGYSDAEYATDKVASIEWDLHNGRQSQKQANMYSSKIDTVKDIITEAYADSEDQETLRAIAEALSIELIREFEFTASIEVSGTYSYNILENDYDLDLESEVTDALFADSQNGNIEITDQEVCNVSER*
Ga0070742_100049984F000311GAGMYFELTAPDKLSFEMAYWDAQIIGLDPHVLSALTFNVGTGSIEKVSKIRDKHNLIESYVSDYEPTGYTGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.