Basic Information | |
---|---|
Taxon OID | 3300005889 Open in IMG/M |
Scaffold ID | Ga0075290_1020885 Open in IMG/M |
Source Dataset Name | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 803 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Twitchell Island, California | |||||||
Coordinates | Lat. (o) | 38.1087 | Long. (o) | -121.653 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074844 | Metagenome / Metatranscriptome | 119 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075290_10208852 | F074844 | GGAGG | VKLQVQRVARTFERSLNAGDLEGCRANLSAEFADRDTDLGPLLERTTGAELIGTVGNRTLLHLDLDDGDSRVVELLWLELHGAWRIHDVRVFSLLPGE* |
⦗Top⦘ |