NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078910_102463

Scaffold Ga0078910_102463


Overview

Basic Information
Taxon OID3300005835 Open in IMG/M
Scaffold IDGa0078910_102463 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5900
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (61.54%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → Archaeoglobaceae → Archaeoglobus → Archaeoglobus sulfaticallidus → Archaeoglobus sulfaticallidus PM70-1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location NameAlnarp, Sweden
CoordinatesLat. (o)59.8152338Long. (o)17.6620518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080199Metagenome / Metatranscriptome115N
F088950Metagenome / Metatranscriptome109N
F103498Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0078910_10246310F088950N/AMDIDGVLKEIAEFIEEKIPELDSKVTTIYPESKRFAPPTVVIDIVAGRENLIIDGTKTHELVRVAIISDKKSEINRIFNLITDAFLNHGRELKTGIYKGISYISPVAPAFVEKNSAMKRELDIVVIEFRKRR*
Ga0078910_1024637F103498GGAMSVQDVNTLRMKKMDSIESCELQHCRLRTDILCEVQRREXKQDERFXALIDELRLDWKETKKEVISIKDTMIQGFIALIVAIIGVYVSYLLLNVNGFL*
Ga0078910_1024639F080199GGAGMKIIVQGVEETNLKLSQILAAVQENVDKTLDLFSSDMTKEIKDSAPYDTGRYMSSWFYERKESLKYAIISQNSYVPYNTYLVFGTEKFKPIANESKYKYSDPERGIIHDIRQIKFIYSIKLGQLIKRVNLLNVNISLAGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.