


| Basic Information | |
|---|---|
| Taxon OID | 3300005826 Open in IMG/M |
| Scaffold ID | Ga0074477_1703983 Open in IMG/M |
| Source Dataset Name | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1322 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ilwaco, Washington, USA | |||||||
| Coordinates | Lat. (o) | 46.31286 | Long. (o) | -123.99663 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073289 | Metagenome / Metatranscriptome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074477_17039832 | F073289 | AGGA | MKLEDYGYCSKTGKCINPFGIKPEWVQKLAAKIRLGLLIDQTEDAPF* |
| ⦗Top⦘ |