NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074474_1432008

Scaffold Ga0074474_1432008


Overview

Basic Information
Taxon OID3300005824 Open in IMG/M
Scaffold IDGa0074474_1432008 Open in IMG/M
Source Dataset NameMicrobial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)968
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameIlwaco, Washington, USA
CoordinatesLat. (o)46.26975Long. (o)-123.94603Alt. (m)Depth (m).02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034767Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0074474_14320082F034767AGGAGMLGSKIAKTTLDILRGANATVWGGVEEAEKVGKIVKTGISGADVVIGTSHALEDFGCNDYVCGSLDVIGSMSSAIGLILGNIPNTKHMTVITGSVTVGCRSVRYYCKRYGTFWGCTIATGQGIKEGFKFVINK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.