NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079971_107201

Scaffold Ga0079971_107201


Overview

Basic Information
Taxon OID3300005807 Open in IMG/M
Scaffold IDGa0079971_107201 Open in IMG/M
Source Dataset NameBasalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1497
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From Loihi, Hawaii, Usa

Source Dataset Sampling Location
Location NameLo'ihi Seamount, Hawai'I
CoordinatesLat. (o)18.92Long. (o)-155.27Alt. (m)Depth (m)5000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007837Metagenome / Metatranscriptome344Y
F016759Metagenome / Metatranscriptome245Y

Sequences

Protein IDFamilyRBSSequence
Ga0079971_1072011F016759GGAMSMEPIQRMMQNPAALAANIPQLMLDAVTQLSFIQLNIPNTILDMYNSPDPTPTNFYTDVLQKNSISTGRSFFTSAMSTASAGRAAVGPIRLASGQLQMESTATSVAGGAAINDNSVVIKFSNGF*
Ga0079971_1072012F007837N/ALVSGLAVLPIISAKNLDLKLRTVVNLKTTXNPXIINFPALQQALAQSMLIDNQDAANPCTVKINGQTNTITIAAGNFRIFNEAWXEQVXITGASTNVQVTSQVSPLQQISVYGGGVTQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.