| Basic Information | |
|---|---|
| Taxon OID | 3300005759 Open in IMG/M |
| Scaffold ID | Ga0078192_101130 Open in IMG/M |
| Source Dataset Name | Scenedesmus quadricauda associated microbial communities from Germany - MZCH: 10104 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | HPI Heinrich-Pette-Institut |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 24762 |
| Total Scaffold Genes | 34 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (73.53%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Green Algae → Unclassified → Unclassified → Scenedesmus Quadricauda Associated → Genome Analysis Of Scenedesmus Quadricauda 10104 And Associated Bacterial Communtity |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Hamburg | |||||||
| Coordinates | Lat. (o) | 53.560155 | Long. (o) | 9.859606 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093954 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078192_10113016 | F093954 | AGGA | MNYVPPEKPVPESIAASLARSEAQIAEGRTVPLEPVLARLRSSIARMQARPETSAPKE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |