Basic Information | |
---|---|
Taxon OID | 3300005664 Open in IMG/M |
Scaffold ID | Ga0073685_1186478 Open in IMG/M |
Source Dataset Name | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Illinois, Urbana-Champaign |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic → Freshwater Viral Communities From Emiquon Reservoir, Havana, Illinois, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Havana, Illinois, USA | |||||||
Coordinates | Lat. (o) | 40.362238 | Long. (o) | -90.047137 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097229 | Metagenome / Metatranscriptome | 104 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073685_11864781 | F097229 | AGGA | MFLVQRKQCSTCIYRADSPLDLNQLEEQVKDPYGGFSGHRVCHHTGKGNEACCAGFWARHKDEFQLGQVAQRMGMV |
⦗Top⦘ |