NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073685_1076078

Scaffold Ga0073685_1076078


Overview

Basic Information
Taxon OID3300005664 Open in IMG/M
Scaffold IDGa0073685_1076078 Open in IMG/M
Source Dataset NameFreshwater viral communities from Emiquon reservoir, Havana, Illinois, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic → Freshwater Viral Communities From Emiquon Reservoir, Havana, Illinois, Usa

Source Dataset Sampling Location
Location NameHavana, Illinois, USA
CoordinatesLat. (o)40.362238Long. (o)-90.047137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090071Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0073685_10760782F090071AGGMTPRRHRRRAPSTGVRRILNRAADRALAARHAEAWYVATVLATGALSWALLTIARALTAATKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.