| Basic Information | |
|---|---|
| Taxon OID | 3300005569 Open in IMG/M |
| Scaffold ID | Ga0066705_10538411 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 726 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California: Angelo Coastal Reserve | |||||||
| Coordinates | Lat. (o) | 39.7392 | Long. (o) | -123.6308 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073352 | Metagenome | 120 | N |
| F081177 | Metagenome | 114 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066705_105384111 | F081177 | N/A | MRDEVKQVSNKAQAAATSAQPYRRHIVGLPLQRSLFVQAARGATTIGLPGLSSELDFPAWLDENGDLFLDRSQVAALSKALPSWFTPETLELMHARHAAACDALVDASENGARAAVSLNGASARKSSEDLANRMALVLAYGILSKFVPD |
| Ga0066705_105384112 | F073352 | N/A | GEHRAGSFVEIDSKFLPGVYQFGVPDEMLAAGAETVTLMLNFPGAVIEPIFIHLVTYDPQDADRLGMAALGPEGRRAALRGAFPRLTAKELGDAR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |