NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068876_10062176

Scaffold Ga0068876_10062176


Overview

Basic Information
Taxon OID3300005527 Open in IMG/M
Scaffold IDGa0068876_10062176 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2260
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003690Metagenome / Metatranscriptome473Y
F008132Metagenome / Metatranscriptome338Y
F014142Metagenome / Metatranscriptome265Y
F057310Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0068876_100621762F003690GGAGMIPNGFEIRISNDYGLELDSFLGAIYLPWHTIGIATALLIAYKIYKRKKINNDY*
Ga0068876_100621763F008132AGGAMMTKWDTIQADVADAYRHLDDVEEIENEEEDFFGFAKAIEIDHLTDEQLDEISKMFGDN*
Ga0068876_100621764F057310AGAAGMKITYSVWQGSLIKGSNFTANTMKEVMKTIDELNETGAKPKFEAFISRVEQDNK*
Ga0068876_100621766F014142AGGAGMNSLNVSVVVEPTHPMSSSNTKDNNIFRLANGNYISRMAYVYMVMSENLISHRYLSPNESKWVFSQRVGN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.