NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074648_1133089

Scaffold Ga0074648_1133089


Overview

Basic Information
Taxon OID3300005512 Open in IMG/M
Scaffold IDGa0074648_1133089 Open in IMG/M
Source Dataset NameSaline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)790
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece

Source Dataset Sampling Location
Location NameGreece: Etoliko Lagoon
CoordinatesLat. (o)38.4825Long. (o)21.315Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083414Metagenome / Metatranscriptome113N
F101494Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0074648_11330891F083414N/AILVILICISGQCNNLYEERLYDSKALCEAEGAVAKQYMMETYPSSSGEIWCLTTDEFQEYYQYLEQQEQLNKPDA*
Ga0074648_11330892F101494N/AMDYYCSAKFAELQVHVQSRLLYNCCKAYPERVDLEWLENNPGRLFHTDTMLEDRALMLDNRPCASCHHGCYKLEEKGLPSTRQQYINTTKITDPRAPLRDLTISLSTDCNMTCMYCAPEWSSSWQRDIDKNGEYRLDGVPVLQNDRWSTLWSKMKQRSRGTETKFFGLLPREIRL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.