Basic Information | |
---|---|
Taxon OID | 3300005487 Open in IMG/M |
Scaffold ID | Ga0074211_103672 Open in IMG/M |
Source Dataset Name | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 873 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Washington, Seattle | |||||||
Coordinates | Lat. (o) | 47.63458 | Long. (o) | -122.26655 | Alt. (m) | Depth (m) | 63 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001964 | Metagenome | 610 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074211_1036721 | F001964 | GGAG | MSRNLFGKPVYKVQLSGAIGWSDMKERVVSYQTVEFSSRKDAERAARELNPGEYTQGRIRVVPVELSEDYDVYPVPERTKANHST* |
⦗Top⦘ |