NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070678_100463176

Scaffold Ga0070678_100463176


Overview

Basic Information
Taxon OID3300005456 Open in IMG/M
Scaffold IDGa0070678_100463176 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1112
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003146Metagenome / Metatranscriptome505Y
F011951Metagenome / Metatranscriptome285Y
F014162Metagenome / Metatranscriptome265N

Sequences

Protein IDFamilyRBSSequence
Ga0070678_1004631761F003146N/ASPAKLAGRMKRRWRVVLLRAKGEILGEVEASDVASAKAAAADRFELDEIQRQRIMVQELQPR*
Ga0070678_1004631762F011951AGGAGVTGAQFEIRIDGTARTYRDRKDYAMEAARLLKSKNPHSMVEVRDLKSGDVTAVANRLG*
Ga0070678_1004631763F014162AGAAGLHPSSEGIPQLFFRTVSVGHEPKSVSRRLRTNHYHSEARVKTMLQQITSNRGRRTTKFTPANIQKIKDWVAQGTRREDIAKSLDVTVGSLQVTCSRLGISLRRRDNDPRVRVESRAFVSNGRVYAGHLQREPSSQAKFQLVLKSEGTEQTTDLAFTAGHVGRLGVEASAQGLGLTDLMSQVLAQALKKGLIQKILEKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.