Basic Information | |
---|---|
Taxon OID | 3300005258 Open in IMG/M |
Scaffold ID | Ga0074071_1070710 Open in IMG/M |
Source Dataset Name | Microbial communities on the surface of bentonite enhanced biochar |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Australian Centre for Ecogenomics |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 621 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Bentonite Enhanced Biochar |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sydney | |||||||
Coordinates | Lat. (o) | -33.917926 | Long. (o) | 151.235347 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044815 | Metagenome / Metatranscriptome | 154 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074071_10707102 | F044815 | N/A | VRSERNRNKKLIVAFHFQFANRAGWNCDACRKNGLEKKRRCGFLPEQERGEPRLVWVRTIAQAEECPISLVTGESLGVVEECFVRRQLGLADMLEMAARKVDALVILR |
⦗Top⦘ |