NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068712_1023037

Scaffold Ga0068712_1023037


Overview

Basic Information
Taxon OID3300005252 Open in IMG/M
Scaffold IDGa0068712_1023037 Open in IMG/M
Source Dataset NameEnrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3221
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp.(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location
Location NameUSA: New Jersey, Arthur Kill intertidal strait
CoordinatesLat. (o)40.58Long. (o)-74.01Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046145Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0068712_10230371F046145AGGAVCLNFYWKLFEWITARYEKTNPGWIKCDHMVLKPKPFSEAKTGFFITNRYLRVLSEKI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.