Basic Information | |
---|---|
Taxon OID | 3300005100 Open in IMG/M |
Scaffold ID | Ga0072724_123377 Open in IMG/M |
Source Dataset Name | Cold seep microbial communities from the Ulleung Basin, East Sea, Korea - Hemire mound |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4154 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Cold Seeps → Unclassified → Cold Seep → Cold Seep Microbial Communities From The Ulleung Basin, East Sea, Korea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hemire Mound, Ulleung Basin East Sea, Korea | |||||||
Coordinates | Lat. (o) | 36.098 | Long. (o) | 130.0788 | Alt. (m) | Depth (m) | .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053775 | Metagenome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072724_1233773 | F053775 | AGGA | MKRAIATIVRVTGTCNAGYQVGAKIIVDLDTACINKEQSGNLCIFALSAVLASMGRIRPGEKALASCPDPATGLGGNVIFSVMKEA* |
⦗Top⦘ |