Basic Information | |
---|---|
Taxon OID | 3300005096 Open in IMG/M |
Scaffold ID | Ga0072503_142125 Open in IMG/M |
Source Dataset Name | Hydrothermal chimney microbial communities from the East Pacific Rise - M vent 7 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3158 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East Pacific Rise | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091343 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072503_1421252 | F091343 | GGA | MWRETRVSRNRKSVMADIVENYQHAALWLIGPDMPGLLRMGATYVLDRGGNIDKDIADKFGEKAVVFLSITAEPDGIRRMDRDKDQLRRDSGCGVVFQPMNSPTVPDEFQQELHGFDIVTDDRPGMIADLTELLEKFSILIVGHAGERYIAPLPEPHARGGQKCVVLLPKEFDLPGFTRELDALVWKYNGMIKTPLRKVPGLLWWW* |
⦗Top⦘ |