Basic Information | |
---|---|
Taxon OID | 3300004870 Open in IMG/M |
Scaffold ID | Ga0071103_123489 Open in IMG/M |
Source Dataset Name | Mid-Atlantic Ridge North Pond Expedition - Sample Bottom Water CTD 2012 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 894 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 22.78 | Long. (o) | -46.09 | Alt. (m) | Depth (m) | 4350 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032861 | Metagenome / Metatranscriptome | 179 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0071103_1234891 | F032861 | AGGAGG | MDINICVDHLGLNSNVYRLDRNSPIPHAIVSWDGPDPQPTQAALEAAWAEIEADPDYQAFLSDPHKNNYPV* |
⦗Top⦘ |