Basic Information | |
---|---|
Taxon OID | 3300004779 Open in IMG/M |
Scaffold ID | Ga0062380_10282972 Open in IMG/M |
Source Dataset Name | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 696 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan, St. Louis River estuary | |||||||
Coordinates | Lat. (o) | 46.6972164 | Long. (o) | -92.3279105 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043095 | Metagenome / Metatranscriptome | 157 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0062380_102829721 | F043095 | N/A | GLCRLTGGGCLNEDGGNRGHKQSTFGGNSSPAHEGGGPTGNEWTHVYRDGRTILFNWHSHDAHVIQCSVVSPGPCSPPAVNTRADFVGTGKYSLGAGSREEDGNMVAYVIDHREGACNRNTRDEYSIVVRTGLVIGEGTIVFQTSGEIDCGNLQIHETPAWLFSGGTGTPGQVGSIESVALLNRAVPNPFTGTMSYAYEVVGQDQPVDIGVYNVAGRLVKSLAKTTQPAGR |
⦗Top⦘ |