NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065861_1008188

Scaffold Ga0065861_1008188


Overview

Basic Information
Taxon OID3300004448 Open in IMG/M
Scaffold IDGa0065861_1008188 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada BC-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4437
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, Canada
CoordinatesLat. (o)47.593411Long. (o)-52.885466Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002149Metagenome / Metatranscriptome589Y
F074558Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0065861_10081882F074558AGGAMADSISYGPFNLYESDAYKQAKAMQAEEEALKLEKLRMDIAKSREEETMSTPIGRAGRAADVAAFLEQEKQKDVGIPIGEQMASKMVAQGGPSILEATKMQGQLDVEARARQARVDAAKNYLAGEKSLLPSADINIDGVKRTVLAPEIGKTSADINQQIFQAQVPQLTKAYMAQGYDPDTAVKMAGSDVTKNLFKAQSSGKVVLTSNDGMSTISYTNEQAQRMWKDPSTPKFIKTQLNNFFGESEQPAAANWIKTRLGR*
Ga0065861_10081885F002149N/AAMWPNLAEWFGWFEKQGMVGIVRDNDGIAGVALARCIKDGQEPNHYVHSEDGENVFVDLTISSKGAKSLGGLLLLLAERFGPRKRITFNRSGKPRSYDYMSFMRKALR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.