Basic Information | |
---|---|
Taxon OID | 3300004369 Open in IMG/M |
Scaffold ID | Ga0065726_10829 Open in IMG/M |
Source Dataset Name | Saline microbial communities from the South Caspian sea - cas-15 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 45962 |
Total Scaffold Genes | 59 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 48 (81.36%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline → Saline Microbial Communities From The South Caspian Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Caspian Sea | |||||||
Coordinates | Lat. (o) | 41.916215 | Long. (o) | 50.672019 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003411 | Metagenome / Metatranscriptome | 488 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0065726_1082910 | F003411 | GGAGG | VQYRRNDPISQVEIENELLRLMSMLEEETETFESLAEDAAKKDALYKANWAKEYLSAKGSIKEREAWADYKLSEESYDFKISEALVRSKREKLTSLRTSIDALRTLNANVRSQVQ* |
⦗Top⦘ |