NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058892_1003227

Scaffold Ga0058892_1003227


Overview

Basic Information
Taxon OID3300004133 Open in IMG/M
Scaffold IDGa0058892_1003227 Open in IMG/M
Source Dataset NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)569
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location NameHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.531427Long. (o)-72.189946Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005001Metagenome / Metatranscriptome415Y

Sequences

Protein IDFamilyRBSSequence
Ga0058892_10032271F005001N/AFQVT*FPALLSTGMHGMEHCEQKRRTIRLSAPRWLVSPAAGSMLPGSPLAASCSGPVARNGFSLACNSCRLSATSISGSKLPACYFASFQVASVPVRPFGSTTAFPDCAGCGRFTAWGPLHFHFPVQPATPTVSTPLRDFCVPRDQSVQLRLLPAGPPDESARFPFAPRRPS*LKFGLRIIVPGPLRFR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.