NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063232_10026616

Scaffold Ga0063232_10026616


Overview

Basic Information
Taxon OID3300004054 Open in IMG/M
Scaffold IDGa0063232_10026616 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1416
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000403Metagenome / Metatranscriptome1177Y
F000903Metagenome / Metatranscriptome843Y
F001897Metagenome / Metatranscriptome620Y

Sequences

Protein IDFamilyRBSSequence
Ga0063232_100266161F000903N/AMMDRIEEVQCMIAAIQHCHDRSADHSSRIVKNLSWFEYVAQMGESMLAEYVVAKKLGYDYTPGITWDKSKADVGNHIEVKWSANPASNLWIQESDRQDRDIAVLVTGSSPKMHIVGWMPVAIAKKPRYRNASQNNWSVPQINLQPIETLQRSNYAHPAI*
Ga0063232_100266162F000403N/AMETASMSDYMEIIYPQKMMARLMCNGEIVEEYKIEQCDKCSQLRRLDHFGYQKGYDKQDNTIWFCGDCR*
Ga0063232_100266163F001897GGAMAAFMDGYEGNKERTDRWIATFPQGRLEAHIIEFNAEKGYVLVQAKAWRNQTEIDPAGIDYAYGYLAAYPDKMKRWMVEDSCTSALMRVMALVMGNTEKATKEVMAAIKTPAADYDYWTTKHGDVPSYKTSAEAEESGTPSFGSSDDSAWLVDATPSCLHGVMRWNQSKPDAIKPWAGYFCSEKIKEKQCRPNWYVMTSDGTWKPQV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.