NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063042_112336

Scaffold Ga0063042_112336


Overview

Basic Information
Taxon OID3300003981 Open in IMG/M
Scaffold IDGa0063042_112336 Open in IMG/M
Source Dataset NameDiffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMax Planck Institute for Plant Breeding Research
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1991
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge

Source Dataset Sampling Location
Location NameMid-Atlantic Ridge
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003561Metagenome479Y

Sequences

Protein IDFamilyRBSSequence
Ga0063042_1123364F003561AGGMNKTNGIDDKIIDLDAFRKEKYTLNICVGGYYANLELGVYLHVVGITDPMHTKNAEQHFIVEDHFGNLVTFSIDDPPPGFVVSNMNEFAAAAMGIPDPDDPQVS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.