Basic Information | |
---|---|
Taxon OID | 3300003981 Open in IMG/M |
Scaffold ID | Ga0063042_105366 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal vent microbial communities from Menez Gwen hydrothermal field, Mid Atlantic ridge - MGW_A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Max Planck Institute for Plant Breeding Research |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3574 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Vent → Diffuse Hydrothermal Vent Microbial Communities From Menez Gwen Hydrothermal Field, Mid Atlantic Ridge |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mid-Atlantic Ridge | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002030 | Metagenome | 601 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063042_1053666 | F002030 | AGCAGG | MIAVLVFGFVVFSTICLWLLIEQRKSWKFLIWFIPSLLVLVSSTYVTYTSILGFPRISIPEKGMYLRHYIDEPKWIYLWILGKNNIPMSYQIVYSRKKHDALEGVRGKAEDGAFMVLGEDQTQGVGDELDGEKGGKSGGGFTIGGDISFYEWDHTENMAPKDIE* |
⦗Top⦘ |