| Basic Information | |
|---|---|
| Taxon OID | 3300003969 Open in IMG/M |
| Scaffold ID | Ga0063589_102839 Open in IMG/M |
| Source Dataset Name | Enrichment cultures from Harmful Algal Blooms in Lake Erie, HABS-00-39861 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2359 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Fryxell, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.611214 | Long. (o) | 163.119356 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097196 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0063589_1028393 | F097196 | N/A | MLTMSKPPISFRLSEDELILLESNQQPGESLSLTAARLLRKQLGVVDGVVDKLETKTSNHLIQDRMDELKSDVNSYVNNRVNELLVRIEALEVKPKTTTRRSTSKVTPKDLEVQS* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |