Basic Information | |
---|---|
Taxon OID | 3300003892 Open in IMG/M |
Scaffold ID | Ga0063012_10240982 Open in IMG/M |
Source Dataset Name | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - CP Core 2, 1cm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediment → Hot Spring Sediment Microbial Communities From Chocolate Pots, Yellowstone National Park, Wyoming That Are Fe(Iii) Reducing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.427936 | Long. (o) | -110.588466 | Alt. (m) | Depth (m) | .01 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098837 | Metagenome / Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063012_102409822 | F098837 | N/A | GAFQAKSFLLPLDIINDLVHRVEEYHRQAQAGVSLDQALRITWELECSELDFMRELLVASSNIAELGFPTNLESKDQHVSRLRELIQRYSS |
⦗Top⦘ |