NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063280_1002965

Scaffold Ga0063280_1002965


Overview

Basic Information
Taxon OID3300003882 Open in IMG/M
Scaffold IDGa0063280_1002965 Open in IMG/M
Source Dataset NamePlastic marine debris microbial communities from the Atlantic Ocean - SEA_0108_20120607_metagen
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17490
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (40.74%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)35.55167Long. (o)-65.65833Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y

Sequences

Protein IDFamilyRBSSequence
Ga0063280_10029659F001506N/AMNRIRFKGRDRFGRLPQNRWIYLDKEETTLIKKRKPTRRSKGKPLQYPKLAETEVKSKTFQIKYYGQLSLAAKFILNSFQNKYIYYAMDDILYQFGLKPTEYETLLAILYSPVLSLQNNYFINFFDIWITEVYLKEVSKTNKFLTKTSETYEQISYITIKFVYTTRVPVKKPDPLW*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.