NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0063277_1142874

Scaffold Ga0063277_1142874


Overview

Basic Information
Taxon OID3300003875 Open in IMG/M
Scaffold IDGa0063277_1142874 Open in IMG/M
Source Dataset NamePlastic marine debris microbial communities from the Atlantic Ocean - SEA_0063_20120523_metagen
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)504
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Plastic Marine Debris Microbial Communities From The Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)27.32333Long. (o)-63.565Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021307Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0063277_11428742F021307N/AMNRILYDNRCRCNEEFSPIKKRQSIGKSEGKSLQYPKSTEVTSKIFQFKYEYNLSSTAKFILNSFQNKYLYYAIDDILYGLKTNLNERDNLLEIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.