NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007880_1000561

Scaffold Ga0007880_1000561


Overview

Basic Information
Taxon OID3300003827 Open in IMG/M
Scaffold IDGa0007880_1000561 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6701
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001201Metagenome / Metatranscriptome749Y
F079411Metagenome115N

Sequences

Protein IDFamilyRBSSequence
Ga0007880_10005611F001201N/AFTLVALASGAFKLCKDACEMYKEGRQIVTDAVKEIDGIVKDAKDVQKKAKGLFGFLTAIFGQDKKINAENAQNVQKAAPKAAKKKKEPPPEFDENLIYQQVSDALIKFFQAYNGLKNYKKEQEELALHATNEEGNEIAIKLVIADLQMEKLNSELSNYMVYHVPSELKDLYSRVNEQIGHIANVQALARREELLAKRKAQWQRNQKADLVKNRMVVSAITVLMILWMWGMILSLTHQL*
Ga0007880_100056114F079411N/AMAYVLSGMMPMVNLKDKLVSLQLKNHFALDDLRMGKATKNDIDTLISAFNITEALAKQNIGDEYQQEIKEAQDALFDCAKRGVEMNYRFIVKGPELKAINFVMQLHDEQLKAATVKDIEVATNYVNQCLTQKRARPILSK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.