| Basic Information | |
|---|---|
| Taxon OID | 3300003787 Open in IMG/M |
| Scaffold ID | Ga0007811_1000030 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21548 |
| Total Scaffold Genes | 32 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (65.62%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Crystal Bog, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 46.0072 | Long. (o) | -89.6063 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037028 | Metagenome | 168 | Y |
| F053744 | Metagenome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0007811_100003011 | F053744 | AGG | MSEASNKPKRLIKLRDDDQIYTQTMAAAFFDLTPRAFKKKEKYFIDSMGNPIEIARTPGGYRHYSLNDILKIAHSLRRANKMTDRQLRLIVLRVDAFKEPIKKHRLRYRKGNNPT* |
| Ga0007811_10000306 | F037028 | AGGA | MTIEKKSFDGPLANYDDNSYDDVVEVVPVESKNELVKEIDLANAEPRELLIYFASRYKEVHGYEYVVEWIKEVAIFKSFKERYKVDAGPMVALLFDKHKGKINDMVMTVTAFSKGSKWIQDTLYIQLQQDKIKEENRPSSEGLMNTDDFLKRFAV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |