Basic Information | |
---|---|
Taxon OID | 3300003669 Open in IMG/M |
Scaffold ID | LSCM4E_1081892 Open in IMG/M |
Source Dataset Name | Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From The Lithgow State Coal Mine, New South Wales, Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lithgow | |||||||
Coordinates | Lat. (o) | -33.460524 | Long. (o) | 150.168149 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047236 | Metagenome / Metatranscriptome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LSCM4E_10818922 | F047236 | GGA | MPVEGRGLSSRPTQHASKDLEIGQPINSDKSSETTDGVTRKSEG |
⦗Top⦘ |