Basic Information | |
---|---|
Taxon OID | 3300003540 Open in IMG/M |
Scaffold ID | FS896DNA_10453687 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1076 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → unclassified Pelagivirus → Pelagibacter phage Eistla EXVC025P | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axial seamount, northeast pacific ocean | |||||||
Coordinates | Lat. (o) | 45.926575 | Long. (o) | -129.979479 | Alt. (m) | Depth (m) | 1507 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105364 | Metagenome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FS896DNA_104536871 | F105364 | AGGAG | MTKQYLRTTKNLYTDYVNGYQVYYSYNTAVGIRYPNNDLYLSENVWSTTTGRHLTWIDGGGKESKESRIKYNDLLEIFKD |
⦗Top⦘ |