| Basic Information | |
|---|---|
| Taxon OID | 3300003509 Open in IMG/M |
| Scaffold ID | FS848_1004106 Open in IMG/M |
| Source Dataset Name | Marine hydrothermal diffuse flow vent microbial communities from the Mid-Cayman Rise, Caribbean Sea - Sample FS848 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3196 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005 | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Diffuse Flow Vent → Marine Hydrothermal Diffuse Flow Vent Microbial Communities From The Mid-Cayman Rise, Caribbean Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid-Cayman Rise | |||||||
| Coordinates | Lat. (o) | 18.376929 | Long. (o) | -81.797906 | Alt. (m) | Depth (m) | 2308 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052659 | Metagenome / Metatranscriptome | 142 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FS848_10041062 | F052659 | N/A | MLLSGNPGTETRSAVFIDGRLISSIPELNYQTIDKLQQGGVPDKVSWMKPSLRGRLRLVKLQAQERNLTIEDLNQSIRSKWVILWAEV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |