NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold INDIC_1835432

Scaffold INDIC_1835432


Overview

Basic Information
Taxon OID3300003475 Open in IMG/M
Scaffold IDINDIC_1835432 Open in IMG/M
Source Dataset NameMarine microbial communities from the Indian Ocean - GS112
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)561
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameIndian Ocean
CoordinatesLat. (o)-8.505Long. (o)80.37556Alt. (m)Depth (m)1.8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103090Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
INDIC_18354321F103090GGAGMSEQPKRTETVEEYIERGGTITRLPDSPNSFYGVELDSPTTTKPTSEITESVEYNRLSWKDIEHDDKIIETDDQYWKAVDAAVDKLMSKYS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.