Basic Information | |
---|---|
Taxon OID | 3300003475 Open in IMG/M |
Scaffold ID | INDIC_1827347 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Indian Ocean - GS112 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 544 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indian Ocean | |||||||
Coordinates | Lat. (o) | -8.505 | Long. (o) | 80.37556 | Alt. (m) | Depth (m) | 1.8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004751 | Metagenome / Metatranscriptome | 425 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
INDIC_18273472 | F004751 | AGGA | MEMIDVLTKLREIAEKKPELVKDAVENVEKTNPKVDEGRMKDYLHSEAEKLSREEFIKNMEKA* |
⦗Top⦘ |