NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NAP4_1004729

Scaffold NAP4_1004729


Overview

Basic Information
Taxon OID3300003474 Open in IMG/M
Scaffold IDNAP4_1004729 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2230
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine → Estuary Microbial Community From Gulf Of Naples, Italy

Source Dataset Sampling Location
Location NameSarno river estuary, Gulf of Naples
CoordinatesLat. (o)40.72683Long. (o)14.46133Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F002374Metagenome / Metatranscriptome566Y
F039389Metagenome164Y

Sequences

Protein IDFamilyRBSSequence
NAP4_10047293F001611AGGAGGMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNVSVNNAEYSKDVSVPALVTGQPFGVLNGAYTNNDLITTGSQRNRVLVRFTNDTGATRTIRCGVFIGG*
NAP4_10047294F039389AGGAGGLAFLGDLGKVFGLGSSKEVLGGFGETVGNIFGIGGTGRRAGEVLAGATSSLASGTADQPLEQSAVPTPGQNGMPQETSRSGSTTTNIIDVSGRGPTSQAGLGVLTPFLPQIAKIFGNRAVQTGLGAGAGIIAGAMAPNGKERPVLTQSRRNKARVRQLVNFLGIEGTAEFLTQQGGVNVTPNDVVMLLLRTFRNDGAYITKAQVRNLRRTTNRFKSLEKQVKEAVSMAKTTRRATPMRRASSTTLIKN*
NAP4_10047295F002374N/AMDQVLLYISVILASVSFFLCLYACARVGKLLNSVKGLDWDTIACLTGDIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKQQSNVTDIKKSNIGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.